224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | B-cell receptor-associated protein 31 |
|---|
Gene and Protein Information
| Gene ID | 10134 |
|---|---|
| Uniprot Accession IDs | P51572 B3KQ79 D3DWV5 Q13836 Q96CF0 BCR-associated protein 31 |
| Ensembl ID | ENSP00000392330 |
| Symbol | BAP31 DXS1357E CDM DDCH BAP31 6C6-AG DXS1357E |
| Family | Belongs to the BCAP29/BCAP31 family. |
| Sequence | MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 696663 | BCAP31 | B-cell receptor associated protein 31 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 27061 | Bcap31 | B cell receptor associated protein 31 | 10090 | MGI:1350933 | Inparanoid, OMA, EggNOG |
| Rat | 293852 | Bcap31 | B-cell receptor-associated protein 31 | 10116 | RGD:1302944 | Inparanoid, OMA |
| Dog | 481080 | BCAP31 | B cell receptor associated protein 31 | 9615 | VGNC:38397 | Inparanoid, OMA, EggNOG |
| Horse | 100058834 | BCAP31 | B cell receptor associated protein 31 | 9796 | VGNC:15781 | Inparanoid, OMA, EggNOG |
| Cow | 533949 | BCAP31 | B cell receptor associated protein 31 | 9913 | VGNC:26436 | Inparanoid, OMA, EggNOG |
| Pig | 100520774 | BCAP31 | B-cell receptor-associated protein 31 | 9823 | OMA, EggNOG | |
| Opossum | 107650310 | BCAP31 | B-cell receptor associated protein 31 | 13616 | OMA, EggNOG | |
| Anole lizard | 100568090 | bcap31 | B-cell receptor associated protein 31 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394579 | bcap31 | B cell receptor associated protein 31 | 8364 | XB-GENE-479512 | Inparanoid, OMA, EggNOG |
| Zebrafish | 368488 | bcap31 | B cell receptor associated protein 31 | 7955 | ZDB-GENE-030616-63 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.