224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Homeobox protein CDX-4 |
|---|
Gene and Protein Information
| Gene ID | 1046 |
|---|---|
| Uniprot Accession IDs | O14627 A1A513 Q5JS20 |
| Ensembl ID | ENSP00000362613 |
| Family | Belongs to the Caudal homeobox family. |
| Sequence | MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 473667 | CDX4 | caudal type homeobox 4 | 9598 | VGNC:1401 | OMA, EggNOG |
| Macaque | 701374 | CDX4 | caudal type homeobox 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12592 | Cdx4 | caudal type homeobox 4 | 10090 | MGI:88362 | Inparanoid, OMA, EggNOG |
| Rat | 302400 | Cdx4 | caudal type homeo box 4 | 10116 | RGD:1561529 | Inparanoid, OMA, EggNOG |
| Dog | 491960 | CDX4 | caudal type homeobox 4 | 9615 | VGNC:39086 | Inparanoid, OMA, EggNOG |
| Horse | 100059663 | CDX4 | caudal type homeobox 4 | 9796 | VGNC:16378 | Inparanoid, OMA, EggNOG |
| Cow | 519648 | CDX4 | caudal type homeobox 4 | 9913 | VGNC:27159 | OMA, EggNOG |
| Pig | 100623433 | CDX4 | caudal type homeobox 4 | 9823 | OMA, EggNOG | |
| Chicken | 395320 | CDX4 | caudal type homeobox 4 | 9031 | CGNC:49264 | Inparanoid, EggNOG |
| Xenopus | 395056 | cdx4 | caudal type homeobox 4 | 8364 | XB-GENE-482787 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein CDX-4
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein CDX-4
protein / nucleic acid binding / DNA binding protein / Homeobox protein CDX-4
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein CDX-4
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein CDX-4
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein CDX-4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.