🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

DRD3

DescriptionD(3) dopamine receptor

Gene and Protein Information

Gene ID1814
Uniprot Accession IDs P35462 A1A4V5 Q4VBM8
Ensembl ID ENSP00000373169
Symbol D3DR ETM1 FET1
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp470885DRD3dopamine receptor D39598VGNC:1797Inparanoid, OMA, EggNOG
Macaque100425047DRD3dopamine receptor D39544OMA, EggNOG
Mouse13490Drd3dopamine receptor D310090MGI:94925Inparanoid, OMA, EggNOG
Rat29238Drd3dopamine receptor D310116RGD:2521Inparanoid, OMA
Dog487984DRD3dopamine receptor D39615VGNC:40095Inparanoid, OMA, EggNOG
Horse100061160DRD3dopamine receptor D39796VGNC:17316Inparanoid, OMA, EggNOG
Cow537043DRD3dopamine receptor D39913VGNC:28208Inparanoid, OMA, EggNOG
Pig100513049DRD3dopamine receptor D39823OMA, EggNOG
Opossum100014112DRD3dopamine receptor D313616Inparanoid, OMA, EggNOG
Chicken770757DRD3dopamine receptor D39031CGNC:11247OMA, EggNOG
Anole lizard100556183drd3dopamine receptor D328377Inparanoid, OMA, EggNOG
Zebrafish282554drd3dopamine receptor D37955ZDB-GENE-021119-1Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    D(3) dopamine receptor
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Dopamine receptor    /    D(3) dopamine receptor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.