🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

AVPR1B

DescriptionVasopressin V1b receptor

Gene and Protein Information

Gene ID553
Uniprot Accession IDs P47901 B0M0J6 Q5TZ00 V1bR
Ensembl ID ENSP00000356094
Symbol AVPR3 VPR3 V1bR AVPR3
FamilyBelongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.
Sequence
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque695963AVPR1Barginine vasopressin receptor 1B9544Inparanoid, OMA
Mouse26361Avpr1barginine vasopressin receptor 1B10090MGI:1347010Inparanoid, OMA
Dog488578AVPR1Barginine vasopressin receptor 1B9615VGNC:38319Inparanoid, OMA
Horse100055260AVPR1Barginine vasopressin receptor 1B9796VGNC:15711Inparanoid, OMA
Cow282861AVPR1Barginine vasopressin receptor 1B9913VGNC:26359Inparanoid, OMA
Pig100517909AVPR1Barginine vasopressin receptor 1B9823Inparanoid, OMA
Opossum100019397AVPR1Barginine vasopressin receptor 1B13616Inparanoid, OMA
Chicken428263AVPR1Barginine vasopressin receptor 1B9031CGNC:505Inparanoid, OMA
Xenopus100487856avpr1barginine vasopressin receptor 1B8364XB-GENE-481094Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Vasopressin v1b receptor
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Vasopressin v1b receptor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.