🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SLC18A2

DescriptionSynaptic vesicular amine transporter

Gene and Protein Information

Gene ID6571
Uniprot Accession IDs Q05940 B2RC96 D3DRC4 Q15876 Q4G147 Q5VW49 Q9H3P6
Ensembl ID ENSP00000298472
Symbol SVMT VMAT2 SVAT SVMT VAT2 VMAT2 PKDYS2
FamilyBelongs to the major facilitator superfamily. Vesicular transporter family.
Sequence
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp466213SLC18A2solute carrier family 18 member A29598VGNC:7861OMA, EggNOG
Macaque701133SLC18A2solute carrier family 18 member A29544OMA, EggNOG
Mouse214084Slc18a2solute carrier family 18 (vesicular monoamine), member 210090MGI:106677Inparanoid, OMA, EggNOG
Rat25549Slc18a2solute carrier family 18 member A210116RGD:3694Inparanoid, OMA, EggNOG
Dog486908SLC18A2solute carrier family 18 member A29615VGNC:46256Inparanoid, OMA, EggNOG
Horse100058805SLC18A2solute carrier family 18 member A29796VGNC:23056Inparanoid, OMA, EggNOG
Cow282471SLC18A2solute carrier family 18 member A29913VGNC:34706Inparanoid, OMA, EggNOG
Pig100154950SLC18A2solute carrier family 18 member A29823Inparanoid, OMA, EggNOG
Opossum100020699SLC18A2solute carrier family 18 member A213616Inparanoid, EggNOG
Chicken423921SLC18A2solute carrier family 18 member A29031CGNC:52082Inparanoid, OMA
Anole lizard100555672slc18a2solute carrier family 18 member A228377Inparanoid, OMA
Zebrafish553304slc18a2solute carrier family 18 (vesicular monoamine transporter), member 27955ZDB-GENE-080514-1Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC18 family of vesicular amine transporters    /    Synaptic vesicular amine transporter

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.