🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

WDFY2

DescriptionWD repeat and FYVE domain-containing protein 2

Gene and Protein Information

Gene ID115825
Uniprot Accession IDs Q96P53 B1AL86 Q96CS1
Ensembl ID ENSP00000298125
Symbol WDF2 ZFYVE22 PROF WDF2 ZFYVE22
Sequence
MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp452730WDFY2WD repeat and FYVE domain containing 29598VGNC:13157OMA, EggNOG
Macaque708929WDFY2WD repeat and FYVE domain containing 29544Inparanoid, OMA, EggNOG
Mouse268752Wdfy2WD repeat and FYVE domain containing 210090MGI:2442811Inparanoid, OMA, EggNOG
Rat305956Wdfy2WD repeat and FYVE domain containing 210116RGD:1307337Inparanoid, OMA
Dog606922WDFY2WD repeat and FYVE domain containing 29615VGNC:54388Inparanoid, OMA, EggNOG
Horse100049955WDFY2WD repeat and FYVE domain containing 29796VGNC:24977Inparanoid, OMA, EggNOG
Opossum100021958WDFY2WD repeat and FYVE domain containing 213616Inparanoid, OMA, EggNOG
PlatypusWDFY2WD repeat and FYVE domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20482]9258OMA, EggNOG
Chicken770107WDFY2WD repeat and FYVE domain containing 29031CGNC:12780Inparanoid, OMA
Anole lizard100565092wdfy2WD repeat and FYVE domain containing 228377Inparanoid, OMA
Xenopus100496386wdfy2WD repeat and FYVE domain containing 28364XB-GENE-961327Inparanoid, OMA
Zebrafish492636wdfy2WD repeat and FYVE domain containing 27955ZDB-GENE-041111-211Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.