🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

WNT8B

DescriptionProtein Wnt-8b

Gene and Protein Information

Gene ID7479
Uniprot Accession IDs Q93098 O00771 Q5VX55 Q8WYK9
Ensembl ID ENSP00000340677
FamilyBelongs to the Wnt family.
Sequence
MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp466182WNT8BWnt family member 8B9598VGNC:9783OMA, EggNOG
Macaque710242WNT8BWnt family member 8B9544Inparanoid, OMA, EggNOG
Mouse22423Wnt8bwingless-type MMTV integration site family, member 8B10090MGI:109485Inparanoid, OMA, EggNOG
Rat293990Wnt8bWnt family member 8B10116RGD:1307644Inparanoid, OMA, EggNOG
Dog486841WNT8BWnt family member 8B9615VGNC:48430Inparanoid, OMA, EggNOG
Horse100070360WNT8BWnt family member 8B9796VGNC:25051Inparanoid, OMA
Cow538720WNT8BWnt family member 8B9913VGNC:36965Inparanoid, OMA
Pig100513655WNT8BWnt family member 8B9823Inparanoid, OMA
Opossum100027787WNT8BWnt family member 8B13616Inparanoid, EggNOG
Chicken428953WNT8BWnt family member 8B9031CGNC:53518Inparanoid, OMA
Anole lizard100564473wnt8bWnt family member 8B28377Inparanoid, OMA
Xenopus100496786wnt8bWnt family member 8B8364XB-GENE-492636OMA, EggNOG
Zebrafish30144wnt8bwingless-type MMTV integration site family, member 8b7955ZDB-GENE-990415-279Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.