224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Zinc finger and BTB domain-containing protein 7A |
|---|
Gene and Protein Information
| Gene ID | 51341 |
|---|---|
| Uniprot Accession IDs | O95365 D6W619 O00456 Q14D41 Q5XG86 |
| Ensembl ID | ENSP00000323670 |
| Symbol | FBI1 LRF ZBTB7 ZNF857A LRF FBI1 FBI-1 TIP21 ZBTB7 ZNF857A pokemon |
| Sequence | MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGAAEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMDYYLKYFSGAHDGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468671 | ZBTB7A | zinc finger and BTB domain containing 7A | 9598 | VGNC:11478 | OMA, EggNOG |
| Mouse | 16969 | Zbtb7a | zinc finger and BTB domain containing 7a | 10090 | MGI:1335091 | Inparanoid, OMA, EggNOG |
| Rat | 117107 | Zbtb7a | zinc finger and BTB domain containing 7a | 10116 | RGD:620946 | Inparanoid, OMA, EggNOG |
| Dog | 485048 | ZBTB7A | zinc finger and BTB domain containing 7A | 9615 | VGNC:48544 | Inparanoid, OMA, EggNOG |
| Cow | 788491 | ZBTB7A | zinc finger and BTB domain containing 7A | 9913 | VGNC:37089 | Inparanoid, OMA, EggNOG |
| Pig | 100625057 | ZBTB7A | zinc finger and BTB domain containing 7A | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | ZBTB7A | zinc finger and BTB domain containing 7A [Source:HGNC Symbol;Acc:HGNC:18078] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | ZBTB7A | zinc finger and BTB domain containing 7A [Source:HGNC Symbol;Acc:HGNC:18078] | 9258 | OMA, EggNOG | ||
| Chicken | 395411 | ZBTB7A | zinc finger and BTB domain containing 7A | 9031 | CGNC:20139 | Inparanoid, OMA |
| Zebrafish | 565670 | zbtb7a | zinc finger and BTB domain containing 7a | 7955 | ZDB-GENE-050208-583 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transcription factor / KRAB box transcription factor / Zinc finger and BTB domain-containing protein 7A
protein / transcription factor / zinc finger transcription factor / Zinc finger and BTB domain-containing protein 7A
protein / transcription factor / KRAB box transcription factor / Zinc finger and BTB domain-containing protein 7A
protein / transcription factor / zinc finger transcription factor / Zinc finger and BTB domain-containing protein 7A
DTO Classes
protein / Transcription factor / Zinc finger transcription factor / C2H2 zinc finger transcription factor / KRAB box transcription factor / Zinc finger and BTB domain-containing protein 7A
protein / Transcription factor / Zinc finger transcription factor / C2H2 zinc finger transcription factor / KRAB box transcription factor / Zinc finger and BTB domain-containing protein 7A
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.