🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ZNHIT1

DescriptionZinc finger HIT domain-containing protein 1

Gene and Protein Information

Gene ID10467
Uniprot Accession IDs O43257 Q6IB12
Ensembl ID ENSP00000304593
Symbol CGBP1 ZNFN4A1 CG1I ZNFN4A1
FamilyBelongs to the ZNHIT1 family.
Sequence
MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp472469ZNHIT1zinc finger HIT-type containing 19598VGNC:4589OMA, EggNOG
Macaque714339ZNHIT1zinc finger HIT-type containing 19544Inparanoid, OMA, EggNOG
Mouse70103Znhit1zinc finger, HIT domain containing 110090MGI:1917353Inparanoid, OMA, EggNOG
Rat100360077Znhit1zinc finger, HIT-type containing 110116RGD:2322870Inparanoid, OMA, EggNOG
Dog479729ZNHIT1zinc finger HIT-type containing 19615VGNC:48835Inparanoid, OMA, EggNOG
Horse100059516ZNHIT1zinc finger HIT-type containing 19796VGNC:25399Inparanoid, OMA, EggNOG
Cow514997ZNHIT1zinc finger HIT-type containing 19913VGNC:37358Inparanoid, OMA, EggNOG
Opossum100016770ZNHIT1zinc finger HIT-type containing 113616Inparanoid, OMA, EggNOG
Xenopus549810znhit1zinc finger, HIT-type containing 18364XB-GENE-5848028Inparanoid, OMA, EggNOG
Zebrafish407699znhit1zinc finger, HIT-type containing 17955ZDB-GENE-050417-272Inparanoid, OMA, EggNOG
C. elegans183878zhit-1Zinc finger, HIT-type6239Inparanoid, OMA, EggNOG
Fruitfly326171CG31917CG31917 gene product from transcript CG31917-RA7227FBgn0031668Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    zinc finger transcription factor    /    Zinc finger HIT domain-containing protein 1
DTO Classes
protein    /    Transcription factor    /    Zinc finger transcription factor    /    Zinc finger HIT domain-containing protein 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.