224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | V-type proton ATPase subunit F |
|---|
Gene and Protein Information
| Gene ID | 9296 |
|---|---|
| Uniprot Accession IDs | Q16864 C9J2K4 Q6IBA8 V-ATPase subunit F |
| Ensembl ID | ENSP00000417378 |
| Symbol | ATP6S14 VATF VATF Vma7 ATP6S14 |
| Family | Belongs to the V-ATPase F subunit family. |
| Sequence | MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 740972 | ATP6V1F | ATPase H+ transporting V1 subunit F | 9598 | OMA, EggNOG | |
| Mouse | 66144 | Atp6v1f | ATPase, H+ transporting, lysosomal V1 subunit F | 10090 | MGI:1913394 | Inparanoid, OMA, EggNOG |
| Rat | 116664 | Atp6v1f | ATPase H+ transporting V1 subunit F | 10116 | RGD:621552 | Inparanoid, OMA |
| Dog | 475199 | ATP6V1F | ATPase H+ transporting V1 subunit F | 9615 | VGNC:38282 | Inparanoid, OMA, EggNOG |
| Cow | 282405 | ATP6V1F | ATPase H+ transporting V1 subunit F | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100518811 | ATP6V1F | ATPase H+ transporting V1 subunit F | 9823 | OMA, EggNOG | |
| Opossum | 100019379 | ATP6V1F | ATPase H+ transporting V1 subunit F | 13616 | OMA, EggNOG | |
| Platypus | 100078376 | ATP6V1F | ATPase H+ transporting V1 subunit F | 9258 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448314 | atp6v1f | ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F | 8364 | XB-GENE-975984 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436799 | atp6v1f | ATPase H+ transporting V1 subunit F | 7955 | ZDB-GENE-040718-259 | Inparanoid, OMA, EggNOG |
| C. elegans | 174596 | vha-9 | Probable V-type proton ATPase subunit F | 6239 | Inparanoid, OMA | |
| Fruitfly | 36731 | Vha14-1 | Vacuolar H[+] ATPase 14kD subunit 1 | 7227 | FBgn0262512 | Inparanoid, EggNOG |
| S.cerevisiae | 852903 | VMA7 | H(+)-transporting V1 sector ATPase subunit F | 4932 | S000003252 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit F
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit F
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.