224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Vascular endothelial growth factor A |
|---|
Gene and Protein Information
| Gene ID | 7422 |
|---|---|
| Uniprot Accession IDs | P15692 B5BU86 H0Y2S8 H0Y407 H0Y414 H0Y462 H0Y8N2 H3BLW7 O60720 O75875 Q074Z4 Q16889 Q5UB46 Q6P0P5 Q96KJ0 Q96L82 Q96NW5 Q9H1W8 Q9H1W9 Q9UH58 Q9UL23 VEGF-A |
| Ensembl ID | ENSP00000478570 |
| Symbol | VEGF VPF VEGF MVCD1 |
| Family | Belongs to the PDGF/VEGF growth factor family. |
| Sequence | MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 574209 | VEGFA | vascular endothelial growth factor A | 9544 | Inparanoid, EggNOG | |
| Mouse | 22339 | Vegfa | vascular endothelial growth factor A | 10090 | MGI:103178 | Inparanoid, OMA, EggNOG |
| Rat | 83785 | Vegfa | vascular endothelial growth factor A | 10116 | RGD:619991 | Inparanoid, OMA, EggNOG |
| Dog | 403802 | VEGFA | vascular endothelial growth factor A | 9615 | VGNC:48250 | Inparanoid, OMA, EggNOG |
| Horse | 100033839 | VEGFA | vascular endothelial growth factor A | 9796 | Inparanoid, EggNOG | |
| Cow | 281572 | VEGFA | vascular endothelial growth factor A | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 397157 | VEGFA | vascular endothelial growth factor A | 9823 | Inparanoid, EggNOG | |
| Opossum | 100012132 | VEGFA | vascular endothelial growth factor A | 13616 | OMA, EggNOG | |
| Chicken | 395909 | VEGFA | vascular endothelial growth factor A | 9031 | CGNC:7830 | Inparanoid, EggNOG |
| Anole lizard | 100568086 | vegfa | vascular endothelial growth factor A | 28377 | Inparanoid, EggNOG | |
| Xenopus | 100038089 | vegfa | vascular endothelial growth factor A | 8364 | XB-GENE-485744 | Inparanoid, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.