224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Polyubiquitin-B |
|---|
Gene and Protein Information
| Gene ID | 7314 |
|---|---|
| Uniprot Accession IDs | P0CG47 P02248 P02249 P02250 P62988 Q29120 Q6LBL4 Q6LDU5 Q8WYN8 Q91887 Q91888 Q9BWD6 Q9BX98 Q9UEF2 Q9UEG1 Q9UEK8 Q9UPK7 |
| Ensembl ID | ENSP00000304697 |
| Symbol | HEL-S-50 |
| Family | Belongs to the ubiquitin family. |
| Sequence | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468372 | UBB | ubiquitin B | 9598 | Inparanoid, OMA | |
| Macaque | 696110 | UBB | ubiquitin B | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22187 | Ubb | ubiquitin B | 10090 | MGI:98888 | Inparanoid, OMA |
| Dog | 479513 | UBB | ubiquitin B | 9615 | VGNC:49664 | OMA, EggNOG |
| Horse | UBB | ubiquitin B [Source:HGNC Symbol;Acc:HGNC:12463] | 9796 | OMA, EggNOG | ||
| Cow | 281370 | UBB | ubiquitin B | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100125968 | UBB | ubiquitin B | 9823 | Inparanoid, OMA | |
| Chicken | 101747587 | UBB | ubiquitin B | 9031 | CGNC:67085 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Ribosomal protein / Polyubiquitin-B
protein / Nucleic acid binding / RNA binding protein / Ribosomal protein / Polyubiquitin-B
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.