224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Ubiquitin-conjugating enzyme E2 T |
|---|
Gene and Protein Information
| Gene ID | 29089 |
|---|---|
| Uniprot Accession IDs | Q9NPD8 Q2TU36 |
| Ensembl ID | ENSP00000356243 |
| Symbol | FANCT PIG50 HSPC150 |
| Family | Belongs to the ubiquitin-conjugating enzyme family. |
| Sequence | MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457628 | UBE2T | ubiquitin conjugating enzyme E2 T | 9598 | VGNC:7020 | OMA, EggNOG |
| Macaque | 705911 | UBE2T | ubiquitin conjugating enzyme E2 T | 9544 | OMA, EggNOG | |
| Mouse | 67196 | Ube2t | ubiquitin-conjugating enzyme E2T | 10090 | MGI:1914446 | Inparanoid, OMA, EggNOG |
| Rat | 360847 | Ube2t | ubiquitin-conjugating enzyme E2T | 10116 | RGD:1310816 | Inparanoid, OMA, EggNOG |
| Dog | 607154 | UBE2T | ubiquitin conjugating enzyme E2 T | 9615 | VGNC:48066 | Inparanoid, OMA, EggNOG |
| Horse | UBE2T | ubiquitin conjugating enzyme E2 T [Source:HGNC Symbol;Acc:HGNC:25009] | 9796 | OMA, EggNOG | ||
| Cow | 505314 | UBE2T | ubiquitin conjugating enzyme E2 T | 9913 | VGNC:36596 | Inparanoid, OMA, EggNOG |
| Chicken | 421149 | UBE2T | ubiquitin conjugating enzyme E2 T | 9031 | CGNC:48 | Inparanoid, OMA, EggNOG |
| Zebrafish | 768152 | ube2t | ubiquitin-conjugating enzyme E2T (putative) | 7955 | ZDB-GENE-061013-547 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.