224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | V-type proton ATPase subunit E 1 |
|---|
Gene and Protein Information
| Gene ID | 529 |
|---|---|
| Uniprot Accession IDs | P36543 A8MUE4 A8MUN4 V-ATPase subunit E 1 |
| Ensembl ID | ENSP00000253413 |
| Symbol | ATP6E ATP6E2 P31 Vma4 ATP6E ARCL2C ATP6E2 ATP6V1E |
| Family | Belongs to the V-ATPase E subunit family. |
| Sequence | MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 709739 | ATP6V1E1 | ATPase H+ transporting V1 subunit E1 | 9544 | OMA, EggNOG | |
| Mouse | 11973 | Atp6v1e1 | ATPase, H+ transporting, lysosomal V1 subunit E1 | 10090 | MGI:894326 | Inparanoid, OMA |
| Rat | 297566 | Atp6v1e1 | ATPase H+ transporting V1 subunit E1 | 10116 | RGD:735157 | Inparanoid, OMA |
| Dog | 477740 | ATP6V1E1 | ATPase H+ transporting V1 subunit E1 | 9615 | Inparanoid, OMA | |
| Horse | 100049854 | ATP6V1E1 | ATPase H+ transporting V1 subunit E1 | 9796 | VGNC:15681 | Inparanoid, OMA |
| Cow | 287017 | ATP6V1E1 | ATPase H+ transporting V1 subunit E1 | 9913 | VGNC:26322 | Inparanoid, OMA, EggNOG |
| Pig | 100156112 | ATP6V1E1 | ATPase H+ transporting V1 subunit E1 | 9823 | Inparanoid, OMA | |
| Chicken | 418162 | ATP6V1E1 | ATPase H+ transporting V1 subunit E1 | 9031 | CGNC:50685 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563341 | atp6v1e1 | ATPase H+ transporting V1 subunit E1 | 28377 | OMA, EggNOG | |
| Xenopus | 394728 | atp6v1e1 | ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 | 8364 | XB-GENE-1006142 | OMA, EggNOG |
| Zebrafish | 192335 | atp6v1e1b | ATPase H+ transporting V1 subunit E1b | 7955 | ZDB-GENE-020419-11 | OMA, EggNOG |
| Zebrafish | 108179059 | atp6v1e1a | ATPase H+ transporting V1 subunit E1a | 7955 | ZDB-GENE-041212-51 | Inparanoid, OMA |
| S.cerevisiae | 854509 | VMA4 | H(+)-transporting V1 sector ATPase subunit E | 4932 | S000005859 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit E 1
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit E 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.