🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

VDAC2

DescriptionVoltage-dependent anion-selective channel protein 2

Gene and Protein Information

Gene ID7417
Uniprot Accession IDs P45880 Q5VWK1 Q5VWK3 Q6IB40 Q7L3J5 Q9BWK8 Q9Y5I6 VDAC-2
Ensembl ID ENSP00000361635
Symbol POR
FamilyBelongs to the eukaryotic mitochondrial porin family.
Sequence
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp471721LOC471721voltage-dependent anion-selective channel protein 29598OMA, EggNOG
Macaque704257VDAC2voltage dependent anion channel 29544Inparanoid, OMA
Mouse22334Vdac2voltage-dependent anion channel 210090MGI:106915Inparanoid, OMA, EggNOG
Rat83531Vdac2voltage-dependent anion channel 210116RGD:621576Inparanoid, OMA, EggNOG
Dog479255VDAC2voltage dependent anion channel 29615VGNC:48247Inparanoid, OMA, EggNOG
Horse100064276VDAC2voltage dependent anion channel 29796VGNC:24896Inparanoid, OMA, EggNOG
Cow282120VDAC2voltage dependent anion channel 29913VGNC:36783Inparanoid, OMA, EggNOG
Pig397659VDAC2voltage dependent anion channel 29823Inparanoid, OMA, EggNOG
Opossum100012461VDAC2voltage dependent anion channel 213616Inparanoid, EggNOG
Platypus100075011VDAC2voltage dependent anion channel 29258Inparanoid, OMA, EggNOG
Chicken395498VDAC2voltage dependent anion channel 29031CGNC:49348Inparanoid, OMA
Anole lizard100565441vdac2voltage dependent anion channel 228377Inparanoid, OMA
Xenopus548947vdac2voltage-dependent anion channel 28364XB-GENE-954839Inparanoid, OMA
Zebrafish322126vdac2voltage-dependent anion channel 27955ZDB-GENE-030131-845Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.