🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TDP1

DescriptionTyrosyl-DNA phosphodiesterase 1

Gene and Protein Information

Gene ID55775
Uniprot Accession IDs Q9NUW8 Q2HXX4 Q86TV8 Q96BK7 Q9NZM7 Q9NZM8 Tyr-DNA phosphodiesterase 1
Ensembl ID ENSP00000337353
FamilyBelongs to the tyrosyl-DNA phosphodiesterase family.
Sequence
MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSETNVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESMLTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp453096TDP1tyrosyl-DNA phosphodiesterase 19598VGNC:6768Inparanoid, OMA, EggNOG
Macaque695338TDP1tyrosyl-DNA phosphodiesterase 19544Inparanoid, OMA, EggNOG
Mouse104884Tdp1tyrosyl-DNA phosphodiesterase 110090MGI:1920036Inparanoid, OMA, EggNOG
Rat314380Tdp1tyrosyl-DNA phosphodiesterase 110116RGD:1309618Inparanoid, OMA, EggNOG
Dog490828TDP1tyrosyl-DNA phosphodiesterase 19615VGNC:47218Inparanoid, OMA, EggNOG
Horse100062463TDP1tyrosyl-DNA phosphodiesterase 19796VGNC:23971Inparanoid, OMA, EggNOG
Cow517053TDP1tyrosyl-DNA phosphodiesterase 19913VGNC:35713Inparanoid, OMA, EggNOG
Pig100153247TDP1tyrosyl-DNA phosphodiesterase 19823OMA, EggNOG
Opossum100015515TDP1tyrosyl-DNA phosphodiesterase 113616Inparanoid, EggNOG
Chicken423403TDP1tyrosyl-DNA phosphodiesterase 19031CGNC:8106Inparanoid, OMA, EggNOG
Anole lizard100563188tdp1tyrosyl-DNA phosphodiesterase 128377Inparanoid, OMA, EggNOG
Xenopus734106tdp1tyrosyl-DNA phosphodiesterase 18364XB-GENE-950568Inparanoid, OMA, EggNOG
Zebrafish571485tdp1tyrosyl-DNA phosphodiesterase 17955ZDB-GENE-090909-1Inparanoid, OMA, EggNOG
C. elegans176996F52C12.1Probable tyrosyl-DNA phosphodiesterase6239Inparanoid, OMA
Fruitfly33530gktglaikit7227FBgn0260817Inparanoid, OMA, EggNOG
S.cerevisiae852525TDP1tyrosyl-DNA phosphodiesterase 14932S000000427Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    phosphodiesterase    /    Tyrosyl-DNA phosphodiesterase 1
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Phosphodiesterase    /    Tyrosyl-DNA phosphodiesterase 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.