224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Ubiquitin carboxyl-terminal hydrolase isozyme L3 |
|---|
Gene and Protein Information
| Gene ID | 7347 |
|---|---|
| Uniprot Accession IDs | P15374 B2R970 Q5TBK8 Q6IBE9 UCH-L3 |
| Ensembl ID | ENSP00000366819 |
| Symbol | UCH-L3 |
| Family | Belongs to the peptidase C12 family. |
| Sequence | MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | UCHL3 | ubiquitin C-terminal hydrolase L3 | 9598 | VGNC:14464 | Inparanoid, OMA | |
| Macaque | 697276 | UCHL3 | ubiquitin C-terminal hydrolase L3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 50933 | Uchl3 | ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) | 10090 | MGI:1355274 | Inparanoid, OMA, EggNOG |
| Rat | Uchl3 | ubiquitin C-terminal hydrolase L3 [Source:RGD Symbol;Acc:1561196] | 10116 | OMA, EggNOG | ||
| Dog | 476947 | UCHL3 | ubiquitin C-terminal hydrolase L3 | 9615 | VGNC:48104 | Inparanoid, OMA, EggNOG |
| Horse | 100052000 | UCHL3 | ubiquitin C-terminal hydrolase L3 | 9796 | VGNC:24761 | Inparanoid, OMA, EggNOG |
| Cow | 520170 | UCHL3 | ubiquitin C-terminal hydrolase L3 | 9913 | VGNC:36632 | Inparanoid, OMA, EggNOG |
| Pig | 768115 | UCHL3 | ubiquitin C-terminal hydrolase L3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012187 | UCHL3 | ubiquitin C-terminal hydrolase L3 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 395626 | UCHL3 | ubiquitin C-terminal hydrolase L3 | 9031 | CGNC:12703 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556573 | uchl3 | ubiquitin C-terminal hydrolase L3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549874 | uchl3 | ubiquitin C-terminal hydrolase L3 | 8364 | XB-GENE-980858 | Inparanoid, OMA, EggNOG |
| Zebrafish | 554104 | uchl3 | ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) | 7955 | ZDB-GENE-050522-158 | Inparanoid, OMA, EggNOG |
| C. elegans | 179039 | ubh-1 | Ubiquitin carboxyl-terminal hydrolase | 6239 | OMA, EggNOG | |
| S.cerevisiae | 853562 | YUH1 | ubiquitin-specific protease YUH1 | 4932 | S000003860 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.