224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Neuronal acetylcholine receptor subunit alpha-5 |
|---|
Gene and Protein Information
| Gene ID | 1138 |
|---|---|
| Uniprot Accession IDs | P30532 Q15824 Q99554 |
| Ensembl ID | ENSP00000299565 |
| Symbol | NACHRA5 LNCR2 |
| Family | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-5/CHRNA5 sub-subfamily. |
| Sequence | MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTLPKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDWKFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 619369 | CHRNA5 | cholinergic receptor nicotinic alpha 5 subunit | 9598 | VGNC:10796 | Inparanoid, OMA, EggNOG |
| Macaque | 574191 | CHRNA5 | cholinergic receptor nicotinic alpha 5 subunit | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 110835 | Chrna5 | cholinergic receptor, nicotinic, alpha polypeptide 5 | 10090 | MGI:87889 | Inparanoid, OMA, EggNOG |
| Rat | 25102 | Chrna5 | cholinergic receptor nicotinic alpha 5 subunit | 10116 | RGD:2347 | Inparanoid, OMA, EggNOG |
| Dog | 482112 | CHRNA5 | cholinergic receptor nicotinic alpha 5 subunit | 9615 | VGNC:49739 | Inparanoid, OMA, EggNOG |
| Horse | 100060416 | CHRNA5 | cholinergic receptor nicotinic alpha 5 subunit | 9796 | VGNC:51482 | Inparanoid, OMA, EggNOG |
| Cow | 282177 | CHRNA5 | cholinergic receptor nicotinic alpha 5 subunit | 9913 | VGNC:27327 | Inparanoid, OMA, EggNOG |
| Pig | 100156023 | CHRNA5 | cholinergic receptor nicotinic alpha 5 subunit | 9823 | OMA, EggNOG | |
| Opossum | 100025774 | CHRNA5 | cholinergic receptor nicotinic alpha 5 subunit | 13616 | Inparanoid, EggNOG | |
| Platypus | CHRNA5 | cholinergic receptor nicotinic alpha 5 subunit [Source:HGNC Symbol;Acc:HGNC:1959] | 9258 | OMA, EggNOG | ||
| Chicken | 386577 | CHRNA5 | cholinergic receptor nicotinic alpha 5 subunit | 9031 | CGNC:49155 | Inparanoid, OMA |
| Xenopus | 100379824 | chrna5 | cholinergic receptor nicotinic alpha 5 subunit | 8364 | XB-GENE-5755296 | Inparanoid, OMA |
| Zebrafish | 550584 | chrna5 | cholinergic receptor, nicotinic, alpha 5 | 7955 | ZDB-GENE-050417-440 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transporter / ligand-gated ion channel / Neuronal acetylcholine receptor subunit alpha-5
protein / transporter / ion channel / Neuronal acetylcholine receptor subunit alpha-5
protein / transporter / acetylcholine receptor / Neuronal acetylcholine receptor subunit alpha-5
protein / transporter / GABA receptor / Neuronal acetylcholine receptor subunit alpha-5
protein / transporter / receptor / Neuronal acetylcholine receptor subunit alpha-5
protein / transporter / ligand-gated ion channel / Neuronal acetylcholine receptor subunit alpha-5
protein / transporter / ion channel / Neuronal acetylcholine receptor subunit alpha-5
protein / transporter / acetylcholine receptor / Neuronal acetylcholine receptor subunit alpha-5
protein / transporter / GABA receptor / Neuronal acetylcholine receptor subunit alpha-5
protein / transporter / receptor / Neuronal acetylcholine receptor subunit alpha-5
DTO Classes
protein / Ion channel / Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family / Acetylcholine receptor subfamily / Alpha-5/CHRNA5 sub-subfamily / Neuronal acetylcholine receptor subunit alpha-5
protein / Ion channel / Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family / Acetylcholine receptor subfamily / Alpha-5/CHRNA5 sub-subfamily / Neuronal acetylcholine receptor subunit alpha-5
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.