224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Muscarinic acetylcholine receptor M5 |
|---|
Gene and Protein Information
| Gene ID | 1133 |
|---|---|
| Uniprot Accession IDs | P08912 Q96RG7 |
| Ensembl ID | ENSP00000372750 |
| Symbol | HM5 |
| Family | Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM5 sub-subfamily. |
| Sequence | MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 503515 | CHRM5 | cholinergic receptor muscarinic 5 | 9598 | VGNC:10166 | Inparanoid, OMA, EggNOG |
| Macaque | 574330 | CHRM5 | cholinergic receptor muscarinic 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 213788 | Chrm5 | cholinergic receptor, muscarinic 5 | 10090 | MGI:109248 | Inparanoid, OMA, EggNOG |
| Rat | 53949 | Chrm5 | cholinergic receptor, muscarinic 5 | 10116 | RGD:620027 | Inparanoid, OMA, EggNOG |
| Dog | 487472 | CHRM5 | cholinergic receptor muscarinic 5 | 9615 | VGNC:39235 | Inparanoid, OMA |
| Horse | 100057856 | CHRM5 | cholinergic receptor muscarinic 5 | 9796 | VGNC:16521 | Inparanoid, OMA |
| Cow | 281686 | CHRM5 | cholinergic receptor muscarinic 5 | 9913 | VGNC:27321 | Inparanoid, OMA |
| Chicken | 428881 | CHRM5 | cholinergic receptor muscarinic 5 | 9031 | CGNC:53502 | Inparanoid, OMA |
| Anole lizard | 100562127 | chrm5 | cholinergic receptor muscarinic 5 | 28377 | Inparanoid, OMA | |
| Xenopus | 100498518 | chrm5 | cholinergic receptor, muscarinic 5 | 8364 | XB-GENE-986590 | Inparanoid, OMA |
| Zebrafish | 553978 | chrm5a | cholinergic receptor, muscarinic 5a | 7955 | ZDB-GENE-080723-32 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Muscarinic acetylcholine receptor M5
protein / receptor / G-protein coupled receptor / Muscarinic acetylcholine receptor M5
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Acetylcholine receptor (muscarinic) / Muscarinic acetylcholine receptor M5
protein / G-protein coupled receptor / Class A rhodopsin like / Acetylcholine receptor (muscarinic) / Muscarinic acetylcholine receptor M5
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.