🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

HTR4

Description5-hydroxytryptamine receptor 4

Gene and Protein Information

Gene ID3360
Uniprot Accession IDs Q13639 C4WYH4 Q546Q1 Q684M0 Q712M9 Q96KH9 Q96KI0 Q9H199 Q9NY73 Q9UBM6 Q9UBT4 Q9UE22 Q9UE23 Q9UQR6 5-HT-4
Ensembl ID ENSP00000353915
Symbol 5-HT4 5-HT4R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp462175HTR45-hydroxytryptamine receptor 49598VGNC:13511OMA, EggNOG
Macaque710046HTR45-hydroxytryptamine receptor 49544Inparanoid, OMA, EggNOG
Mouse15562Htr45 hydroxytryptamine (serotonin) receptor 410090MGI:109246Inparanoid, OMA, EggNOG
Rat25324Htr45-hydroxytryptamine receptor 410116RGD:2850Inparanoid, OMA, EggNOG
Dog489198HTR45-hydroxytryptamine receptor 49615VGNC:41831Inparanoid, OMA, EggNOG
Horse100034053HTR45-hydroxytryptamine receptor 49796VGNC:18907Inparanoid, OMA, EggNOG
Cow317708HTR45-hydroxytryptamine receptor 49913VGNC:30000Inparanoid, OMA, EggNOG
Pig397431HTR45-hydroxytryptamine receptor 49823OMA, EggNOG
Opossum100031563HTR45-hydroxytryptamine receptor 413616Inparanoid, EggNOG
Platypus100075879HTR45-hydroxytryptamine receptor 49258Inparanoid, OMA, EggNOG
Chicken416150HTR45-hydroxytryptamine receptor 49031CGNC:948Inparanoid, OMA, EggNOG
Anole lizard100558724htr45-hydroxytryptamine receptor 428377Inparanoid, OMA, EggNOG
Xenopus100493952htr45-hydroxytryptamine (serotonin) receptor 4, G protein-coupled8364XB-GENE-993770Inparanoid, OMA, EggNOG
Zebrafish101882850htr45-hydroxytryptamine receptor 47955ZDB-GENE-160114-31OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    5-hydroxytryptamine receptor 4
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    5-hydroxytryptamine receptor    /    5-HT4 receptor    /    5-hydroxytryptamine receptor 4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.