224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | 5'-AMP-activated protein kinase subunit gamma-1 |
|---|
Gene and Protein Information
| Gene ID | 5571 |
|---|---|
| Uniprot Accession IDs | P54619 B4DDT7 Q8N7V9 AMPK gamma1 |
| Ensembl ID | ENSP00000323867 |
| Symbol | AMPKG |
| Family | Belongs to the 5'-AMP-activated protein kinase gamma subunit family. |
| Sequence | METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451872 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9598 | VGNC:8504 | OMA, EggNOG |
| Macaque | 709298 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9544 | OMA, EggNOG | |
| Mouse | 19082 | Prkag1 | protein kinase, AMP-activated, gamma 1 non-catalytic subunit | 10090 | MGI:108411 | OMA, EggNOG |
| Dog | 486559 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9615 | VGNC:44972 | OMA, EggNOG |
| Horse | 100034096 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9796 | VGNC:21839 | OMA, EggNOG |
| Cow | 282324 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9913 | VGNC:33322 | OMA, EggNOG |
| Pig | 414426 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9823 | OMA, EggNOG | |
| Opossum | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:9385] | 13616 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / kinase modulator / 5'-AMP-activated protein kinase subunit gamma-1
protein / enzyme modulator / kinase modulator / 5'-AMP-activated protein kinase subunit gamma-1
DTO Classes
protein / Kinase / Protein kinase / CAMK group / CAMKL family / 5'-AMP-activated protein kinase subunit gamma-1
protein / Kinase / Protein kinase / CAMK group / CAMKL family / 5'-AMP-activated protein kinase subunit gamma-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.