224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Apolipoprotein A-I |
|---|
Gene and Protein Information
| Gene ID | 335 |
|---|---|
| Uniprot Accession IDs | P02647 A8K866 Q6LDN9 Q6Q785 Q9UCS8 Q9UCT8 Apo-AI |
| Ensembl ID | ENSP00000236850 |
| Symbol | apo(a) |
| Family | Belongs to the apolipoprotein A1/A4/E family. |
| Sequence | MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107967226 | APOA1 | apolipoprotein A1 | 9598 | VGNC:10228 | Inparanoid, OMA, EggNOG |
| Mouse | 11806 | Apoa1 | apolipoprotein A-I | 10090 | MGI:88049 | Inparanoid, OMA, EggNOG |
| Rat | 25081 | Apoa1 | apolipoprotein A1 | 10116 | RGD:2130 | Inparanoid, OMA, EggNOG |
| Dog | 479427 | APOA1 | apolipoprotein A1 | 9615 | VGNC:37991 | Inparanoid, OMA, EggNOG |
| Horse | 100062583 | APOA1 | apolipoprotein A1 | 9796 | VGNC:15413 | Inparanoid, OMA, EggNOG |
| Cow | 281631 | APOA1 | apolipoprotein A1 | 9913 | VGNC:26022 | Inparanoid, OMA, EggNOG |
| Opossum | 100031668 | APOA1 | apolipoprotein A1 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448709 | apoa1 | apolipoprotein A-I | 8364 | XB-GENE-962591 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.