🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ARL2BP

DescriptionADP-ribosylation factor-like protein 2-binding protein

Gene and Protein Information

Gene ID23568
Uniprot Accession IDs Q9Y2Y0 B3KQJ5 Q504R0 ARF-like 2-binding protein
Ensembl ID ENSP00000219204
Symbol BART BART1 BART RP66 BART1
FamilyBelongs to the ARL2BP family.
Sequence
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp736837ARL2BPADP ribosylation factor like GTPase 2 binding protein9598VGNC:5676Inparanoid, OMA, EggNOG
Mouse107566Arl2bpADP-ribosylation factor-like 2 binding protein10090MGI:1349429Inparanoid, OMA, EggNOG
Rat498910Arl2bpADP-ribosylation factor like GTPase 2 binding protein10116RGD:1561471Inparanoid, OMA
Dog611248ARL2BPADP ribosylation factor like GTPase 2 binding protein9615VGNC:38110Inparanoid, OMA, EggNOG
Horse100062265ARL2BPADP ribosylation factor like GTPase 2 binding protein9796OMA, EggNOG
Cow613462ARL2BPADP ribosylation factor like GTPase 2 binding protein9913VGNC:26142Inparanoid, OMA, EggNOG
Pig100515548ARL2BPADP ribosylation factor like GTPase 2 binding protein9823OMA, EggNOG
Opossum100015942ARL2BPADP ribosylation factor like GTPase 2 binding protein13616Inparanoid, EggNOG
Platypus100073653ARL2BPADP ribosylation factor like GTPase 2 binding protein9258OMA, EggNOG
Anole lizard100565536arl2bpADP ribosylation factor like GTPase 2 binding protein28377Inparanoid, OMA, EggNOG
Xenopus549774arl2bpADP ribosylation factor like GTPase 2 binding protein8364XB-GENE-943387Inparanoid, OMA, EggNOG
Zebrafish393976arl2bpADP-ribosylation factor-like 2 binding protein7955ZDB-GENE-040426-1604Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.