TFAP2A

DescriptionTranscription factor AP-2-alpha

Gene and Protein Information

Gene ID7020
Uniprot Accession IDs P05549 Q13777 Q5TAV5 Q8N1C6 AP2-alpha
Ensembl ID ENSP00000368924
Symbol AP2TF TFAP2 AP-2 BOFS AP2TF TFAP2 AP-2alpha
FamilyBelongs to the AP-2 family.
Sequence
MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque700663TFAP2Atranscription factor AP-2 alpha9544Inparanoid, OMA
Mouse21418Tfap2atranscription factor AP-2, alpha10090MGI:104671Inparanoid, OMA
Rat306862Tfap2atranscription factor AP-2 alpha10116RGD:1310267Inparanoid, OMA
Dog488213TFAP2Atranscription factor AP-2 alpha9615VGNC:47283Inparanoid, OMA
Horse100063009TFAP2Atranscription factor AP-2 alpha9796VGNC:24028Inparanoid, OMA
Cow505849TFAP2Atranscription factor AP-2 alpha9913VGNC:35776Inparanoid, OMA
Pig100049668TFAP2Atranscription factor AP-2 alpha9823Inparanoid, OMA
Opossum100019883TFAP2Atranscription factor AP-2 alpha13616Inparanoid, OMA
Platypus100082770TFAP2Atranscription factor AP-2 alpha9258Inparanoid, OMA
Xenopus395064tfap2atto transcription factor AP-2 alpha8364XB-GENE-481201Inparanoid, OMA
Zebrafish140618tfap2atranscription factor AP-2 alpha7955ZDB-GENE-011212-6Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.