224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Natriuretic peptides B |
|---|
Gene and Protein Information
| Gene ID | 4879 |
|---|---|
| Uniprot Accession IDs | P16860 B0ZBE9 Q6FGY0 Q9P2Q7 |
| Ensembl ID | ENSP00000365651 |
| Symbol | BNP |
| Family | Belongs to the natriuretic peptide family. |
| Sequence | MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469801 | NPPB | natriuretic peptide B | 9598 | VGNC:1418 | OMA, EggNOG |
| Mouse | 18158 | Nppb | natriuretic peptide type B | 10090 | MGI:97368 | Inparanoid, OMA, EggNOG |
| Rat | 25105 | Nppb | natriuretic peptide B | 10116 | RGD:3194 | Inparanoid, OMA, EggNOG |
| Dog | 487441 | NPPB | natriuretic peptide B | 9615 | VGNC:43926 | Inparanoid, OMA, EggNOG |
| Horse | 100056123 | NPPB | natriuretic peptide B | 9796 | VGNC:20845 | Inparanoid, OMA, EggNOG |
| Cow | 508734 | NPPB | natriuretic peptide B | 9913 | VGNC:32211 | Inparanoid, OMA, EggNOG |
| Pig | 396844 | NPPB | natriuretic peptide B | 9823 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.