The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
CXCL13 Description C-X-C motif chemokine 13
Gene and Protein Information Gene ID 10563 Uniprot Accession IDs O43927 Ensembl ID ENSP00000286758 Symbol BCA1 BLC SCYB13 BLC BCA1 ANGIE BCA-1 BLR1L ANGIE2 SCYB13 Family Belongs to the intercrine alpha (chemokine CxC) family. Sequence MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 738275 CXCL13 C-X-C motif chemokine ligand 13 9598 VGNC:8667 OMA, EggNOG Macaque 574224 CXCL13 C-X-C motif chemokine ligand 13 9544 Inparanoid, OMA, EggNOG Mouse 55985 Cxcl13 chemokine (C-X-C motif) ligand 13 10090 MGI:1888499 Inparanoid, OMA, EggNOG Rat 498335 Cxcl13 C-X-C motif chemokine ligand 13 10116 RGD:1564256 Inparanoid, OMA, EggNOG Dog 608156 CXCL13 C-X-C motif chemokine ligand 13 9615 VGNC:39747 Inparanoid, OMA, EggNOG Horse 100629997 CXCL13 C-X-C motif chemokine ligand 13 9796 VGNC:51944 Inparanoid, OMA, EggNOG Cow 511674 CXCL13 C-X-C motif chemokine ligand 13 9913 VGNC:27849 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.