The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
CXCL1 Description Growth-regulated alpha protein
Gene and Protein Information Gene ID 2919 Uniprot Accession IDs P09341 Q9UCR7 Ensembl ID ENSP00000379110 Symbol GRO GRO1 GROA MGSA SCYB1 FSP GRO1 GROa MGSA NAP-3 SCYB1 MGSA-a Family Belongs to the intercrine alpha (chemokine CxC) family. Sequence MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 740567 CXCL1 C-X-C motif chemokine ligand 1 9598 VGNC:8658 OMA, EggNOG Macaque 574223 CXCL3 chemokine (C-X-C motif) ligand 3 9544 Inparanoid, OMA Horse 100056258 MIP-2BETA CXCL3 9796 Inparanoid, OMA Horse 100233237 CXCL2 chemokine (C-X-C motif) ligand 2 9796 OMA, EggNOG Opossum 100023783 LOC100023783 growth-regulated alpha protein 13616 OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.