224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Beta-centractin |
|---|
Gene and Protein Information
| Gene ID | 10120 |
|---|---|
| Uniprot Accession IDs | P42025 D3DVH2 Q53SK5 Q9BRB7 |
| Ensembl ID | ENSP00000289228 |
| Symbol | CTRN2 PC3 ARP1B CTRN2 |
| Family | Belongs to the actin family. ARP1 subfamily. |
| Sequence | MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107973565 | ACTR1B | ARP1 actin-related protein 1 homolog B | 9598 | VGNC:5 | OMA, EggNOG |
| Macaque | 707328 | ACTR1B | ARP1 actin related protein 1 homolog B | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 226977 | Actr1b | ARP1 actin-related protein 1B, centractin beta | 10090 | MGI:1917446 | Inparanoid, OMA, EggNOG |
| Rat | 316333 | Actr1b | ARP1 actin related protein 1 homolog B | 10116 | RGD:1307380 | Inparanoid, OMA, EggNOG |
| Dog | 611680 | ACTR1B | ARP1 actin related protein 1 homolog B | 9615 | VGNC:37553 | Inparanoid, OMA |
| Horse | 100051108 | ACTR1B | ARP1 actin related protein 1 homolog B | 9796 | VGNC:15027 | Inparanoid, OMA |
| Cow | 100125305 | ACTR1B | ARP1 actin related protein 1 homolog B | 9913 | VGNC:54395 | Inparanoid, OMA |
| Anole lizard | 100562971 | actr1b | ARP1 actin related protein 1 homolog B | 28377 | Inparanoid, OMA | |
| Zebrafish | 406681 | actr1 | ARP1 actin related protein 1, centractin | 7955 | ZDB-GENE-040426-2695 | Inparanoid, OMA |
| C. elegans | 175162 | arp-1 | Actin-Related Proteins | 6239 | Inparanoid, OMA | |
| Fruitfly | 41566 | Arp1 | Actin-related protein 1 | 7227 | FBgn0011745 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Cellular structure / Actin family cytoskeletal protein / Actin and actin related protein / Beta-centractin
protein / Cellular structure / Actin family cytoskeletal protein / Actin and actin related protein / Beta-centractin
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.