AGR2

DescriptionAnterior gradient protein 2 homolog

Gene and Protein Information

Gene ID10551
Uniprot Accession IDs O95994 AG-2
Ensembl ID ENSP00000391490
Symbol AG2 AG2 AG-2 HPC8 GOB-4 HAG-2 XAG-2 PDIA17 HEL-S-116
FamilyBelongs to the AGR family.
Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp463277AGR2anterior gradient 2, protein disulphide isomerase family member9598VGNC:7208OMA, EggNOG
Macaque709127AGR2anterior gradient 2, protein disulphide isomerase family member9544Inparanoid, OMA, EggNOG
Mouse23795Agr2anterior gradient 210090MGI:1344405Inparanoid, OMA, EggNOG
Rat298961Agr2anterior gradient 2, protein disulphide isomerase family member10116RGD:1304606Inparanoid, OMA, EggNOG
Dog482333AGR2anterior gradient 2, protein disulphide isomerase family member9615VGNC:37715Inparanoid, OMA, EggNOG
Horse100053075AGR2anterior gradient 2, protein disulphide isomerase family member9796VGNC:15169Inparanoid, OMA, EggNOG
Cow415112AGR2anterior gradient 2, protein disulphide isomerase family member9913VGNC:25740Inparanoid, OMA, EggNOG
Pig100514482AGR2anterior gradient 2, protein disulphide isomerase family member9823Inparanoid, OMA
Opossum100012037AGR2anterior gradient 2, protein disulphide isomerase family member13616Inparanoid, OMA, EggNOG
Platypus100081874AGR2anterior gradient 2, protein disulphide isomerase family member9258Inparanoid, OMA, EggNOG
Chicken420596AGR2anterior gradient 2, protein disulphide isomerase family member9031CGNC:8224Inparanoid, OMA, EggNOG
Anole lizard100557366agr2anterior gradient 2, protein disulphide isomerase family member28377Inparanoid, OMA, EggNOG
Xenopus549381agr2anterior gradient 2, protein disulphide isomerase family member8364XB-GENE-971548Inparanoid, OMA, EggNOG
Zebrafish335616agr2anterior gradient 27955ZDB-GENE-050417-214Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    reductase    /    Anterior gradient protein 2 homolog
protein    /    oxidoreductase    /    surfactant    /    Anterior gradient protein 2 homolog
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Reductase    /    Anterior gradient protein 2 homolog

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.