🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MC2R

DescriptionAdrenocorticotropic hormone receptor

Gene and Protein Information

Gene ID4158
Uniprot Accession IDs Q01718 A8K016 Q3MI45 Q504X6 ACTH receptor
Ensembl ID ENSP00000333821
Symbol ACTHR ACTHR
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque701312MC2Rmelanocortin 2 receptor9544Inparanoid, OMA, EggNOG
Mouse17200Mc2rmelanocortin 2 receptor10090MGI:96928Inparanoid, OMA, EggNOG
Rat282839Mc2rmelanocortin 2 receptor10116RGD:628649Inparanoid, OMA, EggNOG
Dog100855756MC2Rmelanocortin 2 receptor9615VGNC:43066Inparanoid, OMA, EggNOG
Horse100057018MC2Rmelanocortin 2 receptor9796VGNC:20020Inparanoid, OMA, EggNOG
Cow281299MC2Rmelanocortin 2 receptor9913VGNC:31293Inparanoid, OMA, EggNOG
Opossum100018891MC2Rmelanocortin 2 receptor13616Inparanoid, OMA, EggNOG
Platypus100076508MC2Rmelanocortin 2 receptor9258Inparanoid, OMA, EggNOG
Anole lizardMC2Rmelanocortin 2 receptor [Source:HGNC Symbol;Acc:HGNC:6930]28377Inparanoid, OMA
Zebrafish353152mc2rmelanocortin 2 receptor7955ZDB-GENE-030502-2Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Adrenocorticotropic hormone receptor
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Melanocortin receptor    /    Adrenocorticotropic hormone receptor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.