224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Aurora kinase A-interacting protein |
|---|
Gene and Protein Information
| Gene ID | 54998 |
|---|---|
| Uniprot Accession IDs | Q9NWT8 Q5TA36 Q8TBD3 AURKA-interacting protein |
| Ensembl ID | ENSP00000342676 |
| Symbol | AIP AKIP MRPS38 AIP AKIP MRP-S38 |
| Family | Belongs to the mitochondrion-specific ribosomal protein mS38 family. |
| Sequence | MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100611076 | AURKAIP1 | aurora kinase A interacting protein 1 | 9598 | VGNC:451 | OMA, EggNOG |
| Mouse | 66077 | Aurkaip1 | aurora kinase A interacting protein 1 | 10090 | MGI:1913327 | Inparanoid, OMA, EggNOG |
| Dog | 607067 | AURKAIP1 | aurora kinase A interacting protein 1 | 9615 | Inparanoid, EggNOG | |
| Cow | 506359 | AURKAIP1 | aurora kinase A interacting protein 1 | 9913 | VGNC:26350 | Inparanoid, OMA, EggNOG |
| Opossum | AURKAIP1 | aurora kinase A interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:24114] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 419415 | AURKAIP1 | aurora kinase A interacting protein 1 | 9031 | CGNC:50994 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567555 | aurkaip1 | aurora kinase A interacting protein 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 100126015 | aurkaip1 | aurora kinase A interacting protein 1 | 7955 | ZDB-GENE-070928-24 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.