224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | FAD-linked sulfhydryl oxidase ALR |
|---|
Gene and Protein Information
| Gene ID | 2671 |
|---|---|
| Uniprot Accession IDs | P55789 Q53YM6 Q8TAH6 Q9H290 Q9UK40 |
| Ensembl ID | ENSP00000248114 |
| Symbol | ALR HERV1 HPO ALR HPO HSS ERV1 HPO1 HPO2 HERV1 |
| Sequence | MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 694203 | GFER | growth factor, augmenter of liver regeneration | 9544 | Inparanoid, EggNOG | |
| Mouse | 11692 | Gfer | growth factor, augmenter of liver regeneration | 10090 | MGI:107757 | Inparanoid, OMA, EggNOG |
| Rat | 27100 | Gfer | growth factor, augmenter of liver regeneration | 10116 | RGD:61845 | Inparanoid, OMA, EggNOG |
| Dog | 479885 | GFER | growth factor, augmenter of liver regeneration | 9615 | Inparanoid, EggNOG | |
| Horse | 100065617 | GFER | growth factor, augmenter of liver regeneration | 9796 | VGNC:18311 | Inparanoid, OMA, EggNOG |
| Cow | 618423 | GFER | growth factor, augmenter of liver regeneration | 9913 | VGNC:29324 | Inparanoid, OMA, EggNOG |
| Pig | 100515774 | GFER | growth factor, augmenter of liver regeneration | 9823 | OMA, EggNOG | |
| Opossum | GFER | growth factor, augmenter of liver regeneration [Source:HGNC Symbol;Acc:HGNC:4236] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 416547 | GFER | growth factor, augmenter of liver regeneration | 9031 | CGNC:4155 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100551634 | gfer | growth factor, augmenter of liver regeneration | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100488306 | gfer | growth factor, augmenter of liver regeneration | 8364 | XB-GENE-987617 | Inparanoid, OMA, EggNOG |
| Zebrafish | 560433 | gfer | growth factor, augmenter of liver regeneration (ERV1 homolog, S. cerevisiae) | 7955 | ZDB-GENE-060810-186 | Inparanoid, OMA, EggNOG |
| C. elegans | 171611 | F56C11.3 | Sulfhydryl oxidase | 6239 | OMA, EggNOG | |
| Fruitfly | 32991 | Alr | Augmenter of liver regeneration | 7227 | FBgn0031068 | Inparanoid, EggNOG |
| S.cerevisiae | 852916 | ERV1 | flavin-linked sulfhydryl oxidase | 4932 | S000003261 | Inparanoid, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.