224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | ETS-related transcription factor Elf-3 |
|---|
Gene and Protein Information
| Gene ID | 1999 |
|---|---|
| Uniprot Accession IDs | P78545 B2R5Q6 Q6IAP8 Q7RU03 Q7Z3X2 Q8NFG2 Q99718 |
| Ensembl ID | ENSP00000352673 |
| Symbol | ERT ESX JEN ERT ESX EPR-1 ESE-1 |
| Family | Belongs to the ETS family. |
| Sequence | MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739176 | ELF3 | E74 like ETS transcription factor 3 | 9598 | VGNC:8318 | OMA, EggNOG |
| Macaque | 707937 | ELF3 | E74 like ETS transcription factor 3 | 9544 | OMA, EggNOG | |
| Mouse | 13710 | Elf3 | E74-like factor 3 | 10090 | MGI:1101781 | Inparanoid, OMA, EggNOG |
| Rat | 304815 | Elf3 | E74 like ETS transcription factor 3 | 10116 | RGD:1310687 | Inparanoid, OMA, EggNOG |
| Dog | 490235 | ELF3 | E74 like ETS transcription factor 3 | 9615 | VGNC:40300 | Inparanoid, OMA, EggNOG |
| Horse | 100146645 | ELF3 | E74 like ETS transcription factor 3 | 9796 | VGNC:17520 | Inparanoid, OMA, EggNOG |
| Cow | 508503 | ELF3 | E74 like ETS transcription factor 3 | 9913 | VGNC:28428 | Inparanoid, OMA, EggNOG |
| Pig | 100524949 | ELF3 | E74 like ETS transcription factor 3 | 9823 | OMA, EggNOG | |
| Opossum | 100011520 | ELF3 | E74 like ETS transcription factor 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100093097 | ELF3 | E74 like ETS transcription factor 3 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 421177 | ELF3 | E74 like ETS transcription factor 3 | 9031 | CGNC:382 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100554948 | elf3 | E74 like ETS transcription factor 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | ELF3 | E74 like ETS transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:3318] | 8364 | OMA, EggNOG | ||
| Zebrafish | 560869 | elf3 | E74-like factor 3 (ets domain transcription factor, epithelial-specific ) | 7955 | ZDB-GENE-030131-8760 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.