ANGPTL8

DescriptionAngiopoietin-like protein 8

Gene and Protein Information

Gene ID55908
Uniprot Accession IDs Q6UXH0 Q9NQZ1
Ensembl ID ENSP00000479969
Symbol C19orf80 RIFL RIFL TD26 PRO1185 PVPA599 C19orf80
FamilyBelongs to the ANGPTL8 family.
Sequence
MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque106994638ANGPTL8angiopoietin like 89544OMA, EggNOG
Mouse624219Angptl8angiopoietin-like 810090MGI:3643534Inparanoid, OMA, EggNOG
Rat100361444Angptl8angiopoietin-like 810116RGD:2320121OMA, EggNOG
Dog102155149ANGPTL8angiopoietin like 89615VGNC:37864OMA, EggNOG
HorseANGPTL8angiopoietin like 8 [Source:HGNC Symbol;Acc:HGNC:24933]9796OMA, EggNOG
Cow101902412ANGPTL8angiopoietin like 89913VGNC:25896OMA, EggNOG
Opossum103096238ANGPTL8angiopoietin like 813616OMA, EggNOG
Platypus103170718ANGPTL8angiopoietin like 89258OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.