🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GOT2

DescriptionAspartate aminotransferase, mitochondrial

Gene and Protein Information

Gene ID2806
Uniprot Accession IDs P00505 B4DJA6 E7ERW2 Q53FL3 Q9BWA3 mAspAT
Ensembl ID ENSP00000245206
Symbol KAT4 KATIV KYAT4 mitAAT
FamilyBelongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
Sequence
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467989GOT2glutamic-oxaloacetic transaminase 29598VGNC:5779OMA, EggNOG
Macaque707896GOT2glutamic-oxaloacetic transaminase 29544Inparanoid, OMA, EggNOG
Mouse14719Got2glutamatic-oxaloacetic transaminase 2, mitochondrial10090MGI:95792Inparanoid, OMA, EggNOG
Rat25721Got2glutamic-oxaloacetic transaminase 210116RGD:2722Inparanoid, OMA, EggNOG
Dog478103GOT2glutamic-oxaloacetic transaminase 29615OMA, EggNOG
Horse100052607GOT2glutamic-oxaloacetic transaminase 29796Inparanoid, OMA, EggNOG
Cow286886GOT2glutamic-oxaloacetic transaminase 29913VGNC:29503Inparanoid, OMA, EggNOG
Opossum100024896GOT2glutamic-oxaloacetic transaminase 213616Inparanoid, EggNOG
Chicken396533GOT2glutamic-oxaloacetic transaminase 29031CGNC:1656Inparanoid, OMA, EggNOG
Anole lizard100559689got2glutamic-oxaloacetic transaminase 228377Inparanoid, OMA, EggNOG
Xenopus549687got2glutamic-oxaloacetic transaminase 28364XB-GENE-998300Inparanoid, OMA, EggNOG
Zebrafish406688got2aglutamic-oxaloacetic transaminase 2a, mitochondrial7955ZDB-GENE-040426-2703OMA, EggNOG
Zebrafish335974got2bglutamic-oxaloacetic transaminase 2b, mitochondrial7955ZDB-GENE-030131-7917Inparanoid, OMA
C. elegans180897got-2.2Aspartate aminotransferase6239Inparanoid, OMA
S.cerevisiae850714AAT2aspartate transaminase AAT24932S000004017Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.