224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | 14-3-3 protein eta |
|---|
Gene and Protein Information
| Gene ID | 7533 |
|---|---|
| Uniprot Accession IDs | Q04917 |
| Ensembl ID | ENSP00000248975 |
| Symbol | YWHA1 YWHA1 |
| Family | Belongs to the 14-3-3 family. |
| Sequence | MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458778 | YWHAH | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta | 9598 | VGNC:10128 | OMA, EggNOG |
| Macaque | 717016 | YWHAH | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22629 | Ywhah | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide | 10090 | MGI:109194 | Inparanoid, OMA, EggNOG |
| Rat | 25576 | Ywhah | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta | 10116 | RGD:3978 | Inparanoid, OMA |
| Dog | 100687866 | YWHAH | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta | 9615 | VGNC:52975 | Inparanoid, OMA, EggNOG |
| Horse | 100062878 | YWHAH | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta | 9796 | VGNC:50988 | Inparanoid, OMA |
| Opossum | 100016805 | YWHAH | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta | 13616 | Inparanoid, OMA | |
| Platypus | 100073451 | YWHAH | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 416955 | YWHAH | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta | 9031 | CGNC:50393 | Inparanoid, OMA, EggNOG |
| Xenopus | 549622 | ywhah | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta | 8364 | XB-GENE-949031 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.