224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | 14-3-3 protein epsilon |
|---|
Gene and Protein Information
| Gene ID | 7531 |
|---|---|
| Uniprot Accession IDs | P62258 B3KY71 D3DTH5 P29360 P42655 Q4VJB6 Q53XZ5 Q63631 Q7M4R4 14-3-3E |
| Ensembl ID | ENSP00000264335 |
| Symbol | MDS HEL2 MDCR KCIP-1 14-3-3E |
| Family | Belongs to the 14-3-3 family. |
| Sequence | MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454409 | YWHAE | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon | 9598 | VGNC:14225 | Inparanoid, OMA, EggNOG |
| Mouse | 22627 | Ywhae | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide | 10090 | MGI:894689 | Inparanoid, OMA, EggNOG |
| Rat | 29753 | Ywhae | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon | 10116 | RGD:62000 | Inparanoid, OMA, EggNOG |
| Horse | 100059962 | YWHAE | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon | 9796 | VGNC:25118 | Inparanoid, OMA, EggNOG |
| Cow | 282125 | YWHAE | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon | 9913 | VGNC:37045 | Inparanoid, OMA, EggNOG |
| Opossum | YWHAE | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:HGNC Symbol;Acc:HGNC:12851] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | 100089523 | YWHAE | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 417554 | YWHAE | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon | 9031 | CGNC:50550 | Inparanoid, OMA |
| Xenopus | 493518 | ywhae | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon | 8364 | XB-GENE-996375 | Inparanoid, OMA, EggNOG |
| Zebrafish | 322060 | ywhae1 | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1 | 7955 | ZDB-GENE-030131-779 | Inparanoid, OMA, EggNOG |
| Fruitfly | 42186 | 14-3-3epsilon | CG31196 gene product from transcript CG31196-RD | 7227 | FBgn0020238 | Inparanoid, OMA |
| S.cerevisiae | 856924 | BMH1 | 14-3-3 family protein BMH1 | 4932 | S000000979 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.