🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ADORA1

DescriptionAdenosine receptor A1

Gene and Protein Information

Gene ID134
Uniprot Accession IDs P30542 A6NFY5 A6NGP4 A8K1L3 B3KXQ4 D2CGD0 Q6FHK3 Q8TAM8
Ensembl ID ENSP00000356205
Symbol RDC7
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457638ADORA1adenosine A1 receptor9598VGNC:10535OMA, EggNOG
Macaque703638ADORA1adenosine A1 receptor9544Inparanoid, OMA, EggNOG
Mouse11539Adora1adenosine A1 receptor10090MGI:99401Inparanoid, OMA, EggNOG
Rat29290Adora1adenosine A1 receptor10116RGD:2048Inparanoid, OMA, EggNOG
Dog403961ADORA1adenosine A1 receptor9615VGNC:37665Inparanoid, OMA, EggNOG
Horse100052496ADORA1adenosine A1 receptor9796VGNC:15126Inparanoid, OMA, EggNOG
Cow282133ADORA1adenosine A1 receptor9913VGNC:25686Inparanoid, OMA
OpossumADORA1adenosine A1 receptor [Source:HGNC Symbol;Acc:HGNC:262]13616Inparanoid, OMA, EggNOG
Chicken374212ADORA1adenosine A1 receptor9031CGNC:91Inparanoid, OMA, EggNOG
Xenopus100127730adora1adenosine A1 receptor8364XB-GENE-944026Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Adenosine receptor a1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Adenosine receptor    /    Adenosine receptor a1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.