224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | 14-3-3 protein theta |
|---|
Gene and Protein Information
| Gene ID | 10971 |
|---|---|
| Uniprot Accession IDs | P27348 D6W4Z5 Q567U5 Q5TZU8 Q9UP48 |
| Ensembl ID | ENSP00000371267 |
| Symbol | 1C5 HS1 14-3-3 |
| Family | Belongs to the 14-3-3 family. |
| Sequence | MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470302 | YWHAQ | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta | 9598 | VGNC:8259 | OMA, EggNOG |
| Macaque | 694702 | YWHAQ | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22630 | Ywhaq | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta | 10090 | MGI:891963 | Inparanoid, OMA, EggNOG |
| Rat | 25577 | Ywhaq | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta | 10116 | RGD:3979 | Inparanoid, OMA |
| Dog | 479459 | LOC479459 | 14-3-3 protein theta-like | 9615 | OMA, EggNOG | |
| Horse | 100057123 | YWHAQ | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta | 9796 | VGNC:25120 | Inparanoid, OMA, EggNOG |
| Cow | 768311 | YWHAQ | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta | 9913 | VGNC:37047 | Inparanoid, OMA, EggNOG |
| Pig | 100048964 | YWHAQ | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta | 9823 | Inparanoid, OMA, EggNOG | |
| Chicken | 421932 | YWHAQ | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta | 9031 | CGNC:12303 | Inparanoid, OMA |
| Anole lizard | 100559510 | ywhaq | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta | 28377 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.