🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SPOP

DescriptionSpeckle-type POZ protein

Gene and Protein Information

Gene ID8405
Uniprot Accession IDs O43791 B2R6S3 D3DTW7 Q53HJ1
Ensembl ID ENSP00000377001
Symbol TEF2 BTBD32
FamilyBelongs to the Tdpoz family.
Sequence
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp455106SPOPspeckle type BTB/POZ protein9598VGNC:9653OMA, EggNOG
Macaque699711SPOPspeckle type BTB/POZ protein9544Inparanoid, OMA, EggNOG
Mouse20747Spopspeckle-type POZ protein10090MGI:1343085Inparanoid, OMA, EggNOG
Rat287643Spopspeckle type BTB/POZ protein10116RGD:1311613Inparanoid, OMA, EggNOG
Dog480548SPOPspeckle type BTB/POZ protein9615VGNC:46753Inparanoid, OMA, EggNOG
Horse100056116SPOPspeckle type BTB/POZ protein9796VGNC:23530Inparanoid, OMA, EggNOG
Cow530618SPOPspeckle type BTB/POZ protein9913VGNC:35229Inparanoid, OMA, EggNOG
Chicken425528SPOPspeckle type BTB/POZ protein9031CGNC:7549Inparanoid, OMA, EggNOG
Anole lizard100564527spopspeckle type BTB/POZ protein28377Inparanoid, OMA
Xenopus394599spopspeckle type POZ protein8364XB-GENE-1003310Inparanoid, OMA
Zebrafish100005514spopspeckle-type POZ protein7955ZDB-GENE-040426-1378Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.