224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Spexin |
|---|
Gene and Protein Information
| Gene ID | 80763 |
|---|---|
| Uniprot Accession IDs | Q9BT56 B3KND6 |
| Ensembl ID | ENSP00000256969 |
| Symbol | C12orf39 C12orf39 |
| Sequence | MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741806 | SPX | spexin hormone | 9598 | VGNC:5598 | OMA, EggNOG |
| Mouse | 319552 | Spx | spexin hormone | 10090 | MGI:2442262 | Inparanoid, OMA |
| Dog | 102151474 | SPX | spexin hormone | 9615 | VGNC:46784 | OMA, EggNOG |
| Horse | 100147193 | SPX | spexin hormone | 9796 | VGNC:23564 | OMA, EggNOG |
| Cow | 509493 | SPX | spexin hormone | 9913 | VGNC:35262 | Inparanoid, OMA, EggNOG |
| Chicken | 107053973 | SPX | spexin hormone | 9031 | CGNC:76958 | OMA, EggNOG |
| Zebrafish | 101882535 | spx | spexin hormone | 7955 | ZDB-GENE-041210-158 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.