TPPP

DescriptionTubulin polymerization-promoting protein

Gene and Protein Information

Gene ID11076
Uniprot Accession IDs O94811 TPPP
Ensembl ID ENSP00000353785
Symbol TPPP1 p24 p25 TPPP1 TPPP/p25 p25alpha
FamilyBelongs to the TPPP family.
Sequence
MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse72948Tppptubulin polymerization promoting protein10090MGI:1920198Inparanoid, OMA, EggNOG
Rat361466Tppptubulin polymerization promoting protein10116RGD:1310121Inparanoid, OMA, EggNOG
Dog488072TPPPtubulin polymerization promoting protein9615VGNC:47749Inparanoid, OMA, EggNOG
Horse100146662TPPPtubulin polymerization promoting protein9796VGNC:24440Inparanoid, OMA, EggNOG
Cow280968TPPPtubulin polymerization promoting protein9913VGNC:36258Inparanoid, OMA, EggNOG
Opossum100011563TPPPtubulin polymerization promoting protein13616Inparanoid, OMA, EggNOG
Platypus100073989TPPPtubulin polymerization promoting protein9258Inparanoid, OMA, EggNOG
Anole lizard100567725tppptubulin polymerization promoting protein28377Inparanoid, OMA, EggNOG
C. elegans171948tppp-1Tubulin polymerization-promoting protein homolog6239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    non-motor microtubule binding protein    /    Tubulin polymerization-promoting protein
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Non-motor microtubule binding protein    /    Tubulin polymerization-promoting protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.