The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
SUMO1 Description Small ubiquitin-related modifier 1
Gene and Protein Information Gene ID 7341 Uniprot Accession IDs P63165 A8MUS8 B2R4I5 P55856 Q6FGG0 Q6NZ62 Q93068 SUMO-1 Ensembl ID ENSP00000376077 Symbol SMT3C SMT3H3 UBL1 DAP1 GMP1 PIC1 SMT3 UBL1 OFC10 SENP2 SMT3C SMT3H3 Family Belongs to the ubiquitin family. SUMO subfamily. Sequence MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Macaque 703644 SUMO1 small ubiquitin-like modifier 1 9544 OMA, EggNOG Mouse 22218 Sumo1 small ubiquitin-like modifier 1 10090 MGI:1197010 Inparanoid, OMA, EggNOG Rat 301442 Sumo1 small ubiquitin-like modifier 1 10116 RGD:1306919 Inparanoid, OMA, EggNOG Dog 478874 SUMO1 small ubiquitin-like modifier 1 9615 Inparanoid, OMA, EggNOG Horse 100067107 SUMO1 small ubiquitin-like modifier 1 9796 VGNC:51492 Inparanoid, OMA, EggNOG Cow 614967 SUMO1 small ubiquitin-like modifier 1 9913 VGNC:35473 Inparanoid, OMA, EggNOG Opossum 100019119 SUMO1 small ubiquitin-like modifier 1 13616 Inparanoid, OMA, EggNOG Chicken 373930 SUMO1 small ubiquitin-like modifier 1 9031 CGNC:48961 Inparanoid, OMA, EggNOG Anole lizard 100567796 sumo1 small ubiquitin-like modifier 1 28377 Inparanoid, OMA, EggNOG Xenopus 448691 sumo1 small ubiquitin-like modifier 1 8364 XB-GENE-978491 Inparanoid, OMA, EggNOG Zebrafish 406438 sumo1 small ubiquitin-like modifier 1 7955 ZDB-GENE-040426-2186 Inparanoid, OMA, EggNOG C. elegans 266820 smo-1 Small ubiquitin-related modifier 6239 Inparanoid, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.