224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Phosphatidate cytidylyltransferase 2 |
|---|
Gene and Protein Information
| Gene ID | 8760 |
|---|---|
| Uniprot Accession IDs | O95674 B2RDC6 D3DW04 Q5TDY2 Q5TDY3 Q5TDY4 Q5TDY5 Q9BYK5 Q9NTT2 |
| Ensembl ID | ENSP00000419879 |
| Family | Belongs to the CDS family. |
| Sequence | MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469872 | CDS2 | CDP-diacylglycerol synthase 2 | 9598 | VGNC:6075 | Inparanoid, OMA, EggNOG |
| Macaque | 718026 | CDS2 | CDP-diacylglycerol synthase 2 | 9544 | OMA, EggNOG | |
| Mouse | 110911 | Cds2 | CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 | 10090 | MGI:1332236 | Inparanoid, OMA, EggNOG |
| Rat | 114101 | Cds2 | CDP-diacylglycerol synthase 2 | 10116 | RGD:621186 | Inparanoid, OMA, EggNOG |
| Dog | 485780 | CDS2 | CDP-diacylglycerol synthase 2 | 9615 | VGNC:39081 | Inparanoid, OMA, EggNOG |
| Cow | 614834 | CDS2 | CDP-diacylglycerol synthase 2 | 9913 | VGNC:27156 | Inparanoid, OMA, EggNOG |
| Pig | 100170145 | CDS2 | CDP-diacylglycerol synthase 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100032766 | CDS2 | CDP-diacylglycerol synthase 2 | 13616 | Inparanoid, EggNOG | |
| Zebrafish | 394161 | cds2 | CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 | 7955 | ZDB-GENE-030717-4 | Inparanoid, OMA |
| C. elegans | 3565046 | cdgs-1 | Phosphatidate cytidylyltransferase | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 852317 | CDS1 | phosphatidate cytidylyltransferase | 4932 | S000000233 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.