224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Taste receptor type 2 member 30 |
|---|
Gene and Protein Information
| Gene ID | 259293 |
|---|---|
| Uniprot Accession IDs | P59541 Q645X7 T2R30 |
| Ensembl ID | ENSP00000444736 |
| Symbol | TAS2R47 T2R30 T2R47 TAS2R47 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence | MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLWVLLLHWYATQLNPAFYSVEVRITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLRIKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEGNVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAIYFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRGALCVF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100609864 | LOC100609864 | taste receptor type 2 member 30-like | 9598 | OMA, EggNOG | |
| Dog | 100271744 | CAFA-T2R43 | bitter taste receptor Cafa-T2R43 | 9615 | OMA, EggNOG | |
| Horse | 100065752 | LOC100065752 | taste receptor type 2 member 46-like | 9796 | OMA, EggNOG | |
| Cow | 664639 | TAS2R46 | taste receptor, type 2, member 46 | 9913 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 30
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 30
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.