🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

STMN1

DescriptionStathmin

Gene and Protein Information

Gene ID3925
Uniprot Accession IDs P16949 A2A2D1 B2R4E7 B7Z8N4 D3DPJ5
Ensembl ID ENSP00000410452
Symbol C1orf215 LAP18 OP18 Lag SMN OP18 PP17 PP19 PR22 LAP18 C1orf215
FamilyBelongs to the stathmin family.
Sequence
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp456650STMN1stathmin 19598VGNC:53215Inparanoid, OMA, EggNOG
Macaque719733STMN1stathmin 19544Inparanoid, OMA
Mouse16765Stmn1stathmin 110090MGI:96739Inparanoid, OMA
Rat29332Stmn1stathmin 110116RGD:2992Inparanoid, OMA
Dog478175STMN1stathmin 19615VGNC:46925Inparanoid, OMA
Horse100057411STMN1stathmin 19796VGNC:23698Inparanoid, OMA
Cow616317STMN1stathmin 19913Inparanoid, OMA
Pig494463STMN1stathmin 19823Inparanoid, OMA
Opossum100011564STMN1stathmin 113616Inparanoid, OMA
Platypus100083723STMN1stathmin 19258Inparanoid, OMA
Chicken396057STMN1stathmin 19031CGNC:49630Inparanoid, OMA
Anole lizard100568004stmn1stathmin 128377Inparanoid, OMA
Zebrafish678630stmn1astathmin 1a7955ZDB-GENE-031006-14Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.