🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

STX1A

DescriptionSyntaxin-1A

Gene and Protein Information

Gene ID6804
Uniprot Accession IDs Q16623 O15447 O15448 Q12936 Q75MD9 Q7Z5K3 Q9BPZ6
Ensembl ID ENSP00000222812
Symbol STX1 STX1 HPC-1 P35-1 SYN1A
FamilyBelongs to the syntaxin family.
Sequence
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp742605STX1Asyntaxin 1A9598VGNC:4525OMA, EggNOG
Macaque574205STX1Asyntaxin 1A9544Inparanoid, OMA, EggNOG
Mouse20907Stx1asyntaxin 1A (brain)10090MGI:109355Inparanoid, OMA, EggNOG
Rat116470Stx1asyntaxin 1A10116RGD:69430Inparanoid, OMA, EggNOG
Dog100855965STX1Asyntaxin 1A9615VGNC:46954Inparanoid, OMA
Horse100061863STX1Asyntaxin 1A9796VGNC:23729Inparanoid, OMA, EggNOG
Cow788566STX1Asyntaxin 1A9913VGNC:35436Inparanoid, OMA, EggNOG
Opossum100029560STX1Asyntaxin 1A13616Inparanoid, OMA, EggNOG
Xenopus779637stx1asyntaxin 1A8364XB-GENE-976753Inparanoid, OMA
S.cerevisiae855844SSO1syntaxin4932S000006153OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    membrane traffic protein    /    SNARE protein    /    Syntaxin-1A
DTO Classes
protein    /    Transporter    /    SNARE protein    /    Syntaxin-1A

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.