🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TIMP2

DescriptionMetalloproteinase inhibitor 2

Gene and Protein Information

Gene ID7077
Uniprot Accession IDs P16035 Q16121 Q93006 Q9UDF7
Ensembl ID ENSP00000262768
Symbol DDC8 CSC-21K
FamilyBelongs to the protease inhibitor I35 (TIMP) family.
Sequence
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp743167TIMP2TIMP metallopeptidase inhibitor 29598VGNC:9705OMA, EggNOG
Mouse21858Timp2tissue inhibitor of metalloproteinase 210090MGI:98753Inparanoid, OMA, EggNOG
Rat29543Timp2TIMP metallopeptidase inhibitor 210116RGD:61312Inparanoid, OMA, EggNOG
Dog403633TIMP2TIMP metallopeptidase inhibitor 29615Inparanoid, EggNOG
Horse100034134TIMP2TIMP metallopeptidase inhibitor 29796OMA, EggNOG
Cow282093TIMP2TIMP metallopeptidase inhibitor 29913VGNC:35871Inparanoid, OMA, EggNOG
Pig396988TIMP2TIMP metallopeptidase inhibitor 29823OMA, EggNOG
Opossum100030996TIMP2TIMP metallopeptidase inhibitor 213616Inparanoid, OMA, EggNOG
Chicken374178TIMP2TIMP metallopeptidase inhibitor 29031CGNC:49073Inparanoid, OMA
Anole lizard100566015timp2TIMP metallopeptidase inhibitor 228377Inparanoid, OMA, EggNOG
Xenopus548477timp2TIMP metallopeptidase inhibitor 28364XB-GENE-949671Inparanoid, OMA, EggNOG
Zebrafish359835timp2aTIMP metallopeptidase inhibitor 2a7955ZDB-GENE-030612-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.