224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | mRNA decay activator protein ZFP36L1 |
|---|
Gene and Protein Information
| Gene ID | 677 |
|---|---|
| Uniprot Accession IDs | Q07352 Q13851 |
| Ensembl ID | ENSP00000388402 |
| Symbol | BERG36 BRF1 ERF1 RNF162B TIS11B BRF1 ERF1 cMG1 ERF-1 Berg36 TIS11B RNF162B |
| Sequence | MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 12192 | Zfp36l1 | zinc finger protein 36, C3H type-like 1 | 10090 | MGI:107946 | Inparanoid, OMA, EggNOG |
| Rat | 29344 | Zfp36l1 | zinc finger protein 36, C3H type-like 1 | 10116 | RGD:62009 | Inparanoid, OMA |
| Dog | 490748 | ZFP36L1 | ZFP36 ring finger protein like 1 | 9615 | VGNC:48613 | Inparanoid, OMA, EggNOG |
| Horse | 100063597 | ZFP36L1 | ZFP36 ring finger protein like 1 | 9796 | VGNC:25217 | Inparanoid, OMA, EggNOG |
| Cow | 614773 | ZFP36L1 | ZFP36 ring finger protein like 1 | 9913 | VGNC:37163 | Inparanoid, OMA, EggNOG |
| Pig | 100624279 | ZFP36L1 | ZFP36 ring finger protein like 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | ZFP36L1 | ZFP36 ring finger protein like 1 [Source:HGNC Symbol;Acc:HGNC:1107] | 13616 | Inparanoid, EggNOG | ||
| Xenopus | 780215 | zfp36l1 | ZFP36 ring finger protein-like 1 | 8364 | XB-GENE-966625 | Inparanoid, OMA, EggNOG |
| Zebrafish | 561280 | zfp36l1a | zinc finger protein 36, C3H type-like 1a | 7955 | ZDB-GENE-030131-9860 | OMA, EggNOG |
| Zebrafish | 323671 | zfp36l1b | zinc finger protein 36, C3H type-like 1b | 7955 | ZDB-GENE-030131-2391 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / RNA binding protein / mRNA decay activator protein ZFP36L1
protein / nucleic acid binding / RNA binding protein / mRNA decay activator protein ZFP36L1
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA decay activator protein ZFP36L1
protein / Nucleic acid binding / RNA binding protein / mRNA decay activator protein ZFP36L1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.