🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PTGES3

DescriptionProstaglandin E synthase 3

Gene and Protein Information

Gene ID10728
Uniprot Accession IDs Q15185 A8K7D0 B4DHP2 B4DP11 B4DP21 Q8WU70
Ensembl ID ENSP00000482075
Symbol P23 TEBP P23 TEBP cPGES
FamilyBelongs to the p23/wos2 family.
Sequence
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp746021PTGES3prostaglandin E synthase 39598VGNC:5550Inparanoid, OMA, EggNOG
Macaque713353PTGES3prostaglandin E synthase 39544OMA, EggNOG
Mouse56351Ptges3prostaglandin E synthase 310090MGI:1929282Inparanoid, OMA, EggNOG
Rat362809Ptges3prostaglandin E synthase 310116RGD:1561913Inparanoid, OMA, EggNOG
Horse100059858PTGES3prostaglandin E synthase 39796VGNC:21992Inparanoid, OMA, EggNOG
Cow493638PTGES3prostaglandin E synthase 39913VGNC:33507Inparanoid, OMA, EggNOG
Pig100155956PTGES3prostaglandin E synthase 39823OMA, EggNOG
Opossum100014431PTGES3prostaglandin E synthase 313616OMA, EggNOG
Anole lizard100559049ptges3prostaglandin E synthase 328377Inparanoid, OMA, EggNOG
Xenopus492275ptges3prostaglandin E synthase 38364XB-GENE-943096Inparanoid, OMA, EggNOG
Zebrafish406449ptges3aprostaglandin E synthase 3a (cytosolic)7955ZDB-GENE-040426-2200Inparanoid, OMA, EggNOG
C. elegans175727daf-41Co-chaperone protein daf-416239Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.